PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012170-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 329aa    MW: 37857.6 Da    PI: 8.0933
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012170-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.44.5e-20147194148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT+eEd++l+++++ +G + Wk++a++ g++R++k+c++rw++yl
    NNU_012170-RA 147 RGAWTAEEDQRLAQYIEIHGAKKWKLVAAKAGLNRCGKSCRLRWLNYL 194
                      89********************************************97 PP

2Myb_DNA-binding49.78.6e-16200245148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
    NNU_012170-RA 200 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 245
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.694142198IPR017930Myb domain
SMARTSM007175.3E-16146196IPR001005SANT/Myb domain
SuperFamilySSF466893.08E-29146241IPR009057Homeodomain-like
PfamPF002491.8E-18147194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-24148201IPR009057Homeodomain-like
CDDcd001674.18E-11149194No hitNo description
SMARTSM007171.9E-15199247IPR001005SANT/Myb domain
PROSITE profilePS5129420.918199249IPR017930Myb domain
PfamPF002493.6E-14200245IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-24202250IPR009057Homeodomain-like
CDDcd001675.91E-10204245No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009957Biological Processepidermal cell fate specification
GO:0010090Biological Processtrichome morphogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0048629Biological Processtrichome patterning
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MENWKFTEVQ EKNVQSPTPN HDSSEFVAHV KIPQLALLDG NYGLATKVLK PCYGSLYKRT  60
MISTSKQQPL SSDFSTHHSH SPVSSSYIGS WVLPSRTIEE ARKDSYITNP QILIFITLSP  120
TLLHKPTNTR TLMAPKNEEP TKKFVNRGAW TAEEDQRLAQ YIEIHGAKKW KLVAAKAGLN  180
RCGKSCRLRW LNYLRPNIKR GNISDQEEDL ILRLHKLLGN RWSLIAGRLP GRTDNEIKNY  240
WNSHLSKKIN QTKPKPQPSE SSTTTDEPKS EKSWEEIDQL EVSEKSNKEV GESDTSFNVD  300
DFFDFSSEES FTLEWMNKFF ELDEGLYFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-281472507109B-MYB
1h8a_C5e-2814524925128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264377.11e-144PREDICTED: transcription factor MYB114-like
TrEMBLA0A059CIQ32e-88A0A059CIQ3_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s23780.13e-84(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.13e-52myb domain protein 66